PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4579400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 324aa    MW: 37166.9 Da    PI: 7.1638
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4579400.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.87.5e-52111381128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhP+deel+v+yL++kv++ +l++ ++i+e+++yk++Pw+Lp+k+  +e+ewyfF++rd+ky++g r+nra+ sgyWkatg+dk++l+
  Lj1g3v4579400.1  11 LPPGFRFHPSDEELIVHYLRNKVTSCPLPA-SFIAEIELYKYNPWELPSKALFGEEEWYFFTPRDRKYPKGVRPNRAAGSGYWKATGTDKPILT 103
                      79****************************.89***************8777899**************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + + + +g+kk Lvfykgr pkg+ktdWvmheyrl
  Lj1g3v4579400.1 104 ScGMKSIGVKKALVFYKGRPPKGSKTDWVMHEYRL 138
                      977888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-639165IPR003441NAC domain
PROSITE profilePS5100560.26911165IPR003441NAC domain
PfamPF023651.6E-2712138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDKDPNLEIQ LPPGFRFHPS DEELIVHYLR NKVTSCPLPA SFIAEIELYK YNPWELPSKA  60
LFGEEEWYFF TPRDRKYPKG VRPNRAAGSG YWKATGTDKP ILTSCGMKSI GVKKALVFYK  120
GRPPKGSKTD WVMHEYRLHD SMISNSKQRG SMRLDEWVLC RVRQKISSPR STWEESNEHS  180
YEPVTSNFQQ INESSYSEPV KNSAQNEFPM LPYILASKTV LPNSIGISSS SGFGSNGNDD  240
IKPYASLHED SLSIMEAKFL ASATECLLNP LKRKATEENE LDFYAVNKKL CKEVDDREQK  300
HETDTAIGYN FNYFNQWTSI MQPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-7021688168NO APICAL MERISTEM PROTEIN
1ut4_B7e-7021688168NO APICAL MERISTEM PROTEIN
1ut7_A7e-7021688168NO APICAL MERISTEM PROTEIN
1ut7_B7e-7021688168NO APICAL MERISTEM PROTEIN
3swm_A8e-70216811171NAC domain-containing protein 19
3swm_B8e-70216811171NAC domain-containing protein 19
3swm_C8e-70216811171NAC domain-containing protein 19
3swm_D8e-70216811171NAC domain-containing protein 19
3swp_A8e-70216811171NAC domain-containing protein 19
3swp_B8e-70216811171NAC domain-containing protein 19
3swp_C8e-70216811171NAC domain-containing protein 19
3swp_D8e-70216811171NAC domain-containing protein 19
4dul_A7e-7021688168NAC domain-containing protein 19
4dul_B7e-7021688168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0102930.0AP010293.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjB07N04, BM1879, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553546.21e-180PREDICTED: NAC domain-containing protein 67-like isoform X2
SwissprotQ8GY423e-82NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0B2NYY21e-180A0A0B2NYY2_GLYSO; NAC domain-containing protein 29
TrEMBLK7MZ041e-180K7MZ04_SOYBN; Uncharacterized protein
STRINGGLYMA19G36421.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.13e-83NAC domain containing protein 25